PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn116691
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LBD
Protein Properties Length: 178aa    MW: 19374.1 Da    PI: 6.7465
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn116691genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.52.3e-4310108199
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrrkC ++C++apyfp e+p+kf  vhk+FGasnv+k+l++l +++re+a++sl+yeAear+rdPvyG+vg i+ lq+q+e+l+ el+ +++
  Achn116691  10 PCAACKFLRRKCMPGCIFAPYFPPEEPQKFIHVHKIFGASNVSKILNELLPHQRENAVNSLAYEAEARIRDPVYGCVGAISLLQRQVERLQRELEIVNA 108
                 7*********************************************************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.2959110IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-4210107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MASTSIYNSP CAACKFLRRK CMPGCIFAPY FPPEEPQKFI HVHKIFGASN VSKILNELLP  60
HQRENAVNSL AYEAEARIRD PVYGCVGAIS LLQRQVERLQ RELEIVNADL IRYACGEIPT  120
ALPDPGGLQD GSSADSVVEF TRRIGNGGGG FYQTPSLPFP YPLPWNDSPS GGGEGKF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002322187.25e-93hypothetical protein POPTR_0015s09370g
RefseqXP_011046208.15e-93PREDICTED: protein LATERAL ORGAN BOUNDARIES
RefseqXP_011046209.15e-93PREDICTED: protein LATERAL ORGAN BOUNDARIES
SwissprotQ9FML43e-67LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLB9IEW95e-93B9IEW9_POPTR; Uncharacterized protein
STRINGPOPTR_0015s09370.11e-92(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.42e-68LBD family protein